PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000201945
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family WRKY
Protein Properties Length: 240aa    MW: 26276.5 Da    PI: 6.5125
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000201945genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.92.1e-332076360
                   -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
           WRKY  3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60
                   DgynWrKYGqK+vkgse+prsYY+Ct+++Cpvkkkvers  d+++ ei+Y+geHnh+k
  MDP0000201945 20 DGYNWRKYGQKQVKGSEYPRSYYKCTHPNCPVKKKVERSL-DGQIAEIVYKGEHNHSK 76
                   9***************************************.***************85 PP

2WRKY25.92e-08220235318
                    -SS-EEEEEEE--TT- CS
           WRKY   3 DgynWrKYGqKevkgs 18 
                    Dg++WrKYGqK+vkg 
  MDP0000201945 220 DGFRWRKYGQKVVKGE 235
                    9*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.0E-31577IPR003657WRKY domain
SuperFamilySSF1182901.31E-261577IPR003657WRKY domain
SMARTSM007743.8E-371876IPR003657WRKY domain
PROSITE profilePS5081123.6862077IPR003657WRKY domain
PfamPF031065.2E-262074IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.4E-9204235IPR003657WRKY domain
SuperFamilySSF1182901.7E-6211236IPR003657WRKY domain
PROSITE profilePS5081110.338213240IPR003657WRKY domain
PfamPF031061.5E-4220235IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MEEDPKIVPS TANTDRPSYD GYNWRKYGQK QVKGSEYPRS YYKCTHPNCP VKKKVERSLD  60
GQIAEIVYKG EHNHSKPQPP KRXSSGTQGL GVASDGTGQD TNNRLCNSHH NERNDGSEVR  120
LEDQNEVGLP VHFYQSKALL PYDPLASGGI NGGGATPDNS CGLSGECEEG SKGLEAEDCE  180
PRSKRRKSEN QSNEAGISGE GVQDPRVVVQ SSVESDMTGD GFRWRKYGQK VVKGESIIPG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A9e-19677274WRKY transcription factor 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.116540.0stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ0201090.0KJ020109.1 Malus hybrid cultivar TTG2 protein (TTG2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008350407.11e-177PREDICTED: WRKY transcription factor 44-like
SwissprotQ9ZUU08e-58WRK44_ARATH; WRKY transcription factor 44
TrEMBLM5VZ011e-152M5VZ01_PRUPE; Uncharacterized protein
STRINGVIT_08s0040g03070.t011e-118(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67903450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37260.21e-59WRKY family protein